Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HET0

Protein Details
Accession C6HET0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-104SVGIDNPKSEKKKKKESNSKSRKGYPILHydrophilic
NLS Segment(s)
PositionSequence
84-99KSEKKKKKESNSKSRK
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
Amino Acid Sequences MRRKHFVFQYLFFDVGRTRQGCGCPGAYLADIFPPDLRKKSSSHVSRRVVPTRESNYTNLPDSSNRDKRELPTGSQSVGIDNPKSEKKKKKESNSKSRKGYPILESAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.27
4 0.21
5 0.19
6 0.22
7 0.24
8 0.25
9 0.27
10 0.25
11 0.19
12 0.19
13 0.19
14 0.16
15 0.14
16 0.12
17 0.11
18 0.1
19 0.09
20 0.1
21 0.12
22 0.15
23 0.17
24 0.2
25 0.2
26 0.22
27 0.28
28 0.36
29 0.41
30 0.48
31 0.55
32 0.56
33 0.6
34 0.64
35 0.65
36 0.58
37 0.51
38 0.49
39 0.45
40 0.45
41 0.41
42 0.36
43 0.33
44 0.32
45 0.31
46 0.25
47 0.21
48 0.19
49 0.23
50 0.31
51 0.34
52 0.34
53 0.36
54 0.37
55 0.38
56 0.45
57 0.42
58 0.35
59 0.36
60 0.35
61 0.32
62 0.32
63 0.3
64 0.23
65 0.23
66 0.23
67 0.16
68 0.16
69 0.19
70 0.25
71 0.32
72 0.4
73 0.47
74 0.54
75 0.65
76 0.74
77 0.81
78 0.85
79 0.89
80 0.92
81 0.93
82 0.93
83 0.91
84 0.89
85 0.85
86 0.79
87 0.75
88 0.68