Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HAS3

Protein Details
Accession C6HAS3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-111GRGARAKKRRGATKAKGNSRKVRANABasic
NLS Segment(s)
PositionSequence
84-115RGGRGARAKKRRGATKAKGNSRKVRANASRGG
Subcellular Location(s) mito 17, extr 5, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MAGTTMQELVQFLLKLAGSLAPFISPSSSCRLHKYDAVNENVVQTKGLRVLPAVARIEEDRLHGEFLLPYIYVLFSWIKKFACRGGRGARAKKRRGATKAKGNSRKVRANASRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.12
5 0.09
6 0.1
7 0.1
8 0.08
9 0.09
10 0.09
11 0.1
12 0.08
13 0.1
14 0.15
15 0.2
16 0.22
17 0.27
18 0.3
19 0.31
20 0.36
21 0.39
22 0.42
23 0.43
24 0.45
25 0.41
26 0.38
27 0.37
28 0.33
29 0.28
30 0.2
31 0.14
32 0.11
33 0.12
34 0.12
35 0.1
36 0.09
37 0.11
38 0.12
39 0.16
40 0.15
41 0.13
42 0.13
43 0.13
44 0.15
45 0.12
46 0.13
47 0.1
48 0.1
49 0.11
50 0.09
51 0.1
52 0.08
53 0.08
54 0.08
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.06
61 0.07
62 0.08
63 0.1
64 0.13
65 0.14
66 0.15
67 0.17
68 0.22
69 0.28
70 0.29
71 0.34
72 0.39
73 0.48
74 0.56
75 0.64
76 0.67
77 0.7
78 0.74
79 0.74
80 0.75
81 0.75
82 0.75
83 0.76
84 0.76
85 0.77
86 0.81
87 0.84
88 0.85
89 0.85
90 0.86
91 0.83
92 0.83
93 0.76
94 0.77
95 0.74