Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A8S1

Protein Details
Accession A0A1S8A8S1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-79LSTPLPKRRNRLPGKRKVKSCTHydrophilic
NLS Segment(s)
PositionSequence
63-75PKRRNRLPGKRKV
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MQASDQGSDRDSDRGSDRDSDRGSDRDNIMSKTAGQKAKKGRTPLKQSVTSRAVATPLSTPLPKRRNRLPGKRKVKSCTACRASHCSLMQGQHAPTPSQRASASSPDVIDPKSPQAEALQRIASASLALMAEKPQDVSSPESDVYMDDLIVESPVRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.31
4 0.32
5 0.36
6 0.37
7 0.37
8 0.37
9 0.37
10 0.37
11 0.35
12 0.35
13 0.34
14 0.36
15 0.34
16 0.32
17 0.29
18 0.28
19 0.29
20 0.34
21 0.34
22 0.32
23 0.38
24 0.46
25 0.54
26 0.57
27 0.6
28 0.62
29 0.65
30 0.73
31 0.75
32 0.73
33 0.72
34 0.69
35 0.69
36 0.63
37 0.55
38 0.46
39 0.37
40 0.31
41 0.22
42 0.21
43 0.13
44 0.12
45 0.13
46 0.13
47 0.15
48 0.23
49 0.31
50 0.36
51 0.4
52 0.47
53 0.55
54 0.64
55 0.73
56 0.75
57 0.77
58 0.82
59 0.84
60 0.82
61 0.75
62 0.75
63 0.71
64 0.66
65 0.66
66 0.61
67 0.57
68 0.54
69 0.57
70 0.49
71 0.47
72 0.41
73 0.32
74 0.29
75 0.27
76 0.26
77 0.21
78 0.19
79 0.16
80 0.17
81 0.16
82 0.15
83 0.19
84 0.17
85 0.18
86 0.17
87 0.18
88 0.2
89 0.23
90 0.25
91 0.21
92 0.21
93 0.19
94 0.21
95 0.19
96 0.17
97 0.15
98 0.16
99 0.17
100 0.16
101 0.15
102 0.18
103 0.23
104 0.24
105 0.26
106 0.23
107 0.21
108 0.21
109 0.21
110 0.17
111 0.11
112 0.08
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.08
119 0.08
120 0.09
121 0.08
122 0.1
123 0.12
124 0.16
125 0.17
126 0.2
127 0.2
128 0.19
129 0.19
130 0.18
131 0.18
132 0.14
133 0.12
134 0.08
135 0.09
136 0.08
137 0.09
138 0.09