Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S7UHZ0

Protein Details
Accession A0A1S7UHZ0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-46EDPFRDPTPPPRRPKSKRARWRGGRARGDWBasic
NLS Segment(s)
PositionSequence
25-43PPPRRPKSKRARWRGGRAR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSLSKTTTAAASPAEGEDPFRDPTPPPRRPKSKRARWRGGRARGDWESLDSVQDSARDLPPMRLIDADDFRLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.11
5 0.14
6 0.15
7 0.15
8 0.15
9 0.16
10 0.26
11 0.35
12 0.42
13 0.47
14 0.55
15 0.65
16 0.71
17 0.8
18 0.81
19 0.82
20 0.83
21 0.86
22 0.87
23 0.85
24 0.89
25 0.88
26 0.87
27 0.82
28 0.73
29 0.7
30 0.6
31 0.54
32 0.43
33 0.35
34 0.28
35 0.21
36 0.2
37 0.14
38 0.13
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.15
45 0.16
46 0.18
47 0.23
48 0.24
49 0.23
50 0.22
51 0.22
52 0.26
53 0.28