Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HDZ5

Protein Details
Accession C6HDZ5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-123VVEAERREKRRQMRKLGERVDELBasic
NLS Segment(s)
PositionSequence
109-111KRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MFGPDPKNPSPTATTSTTQKRLPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERREKRRQMRKLGERVDELLGAVEGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.46
4 0.48
5 0.47
6 0.5
7 0.54
8 0.58
9 0.6
10 0.59
11 0.58
12 0.57
13 0.59
14 0.52
15 0.45
16 0.36
17 0.32
18 0.26
19 0.21
20 0.19
21 0.17
22 0.16
23 0.15
24 0.16
25 0.17
26 0.17
27 0.17
28 0.15
29 0.13
30 0.15
31 0.15
32 0.18
33 0.21
34 0.23
35 0.21
36 0.2
37 0.22
38 0.21
39 0.22
40 0.22
41 0.21
42 0.19
43 0.24
44 0.24
45 0.22
46 0.23
47 0.23
48 0.19
49 0.18
50 0.18
51 0.16
52 0.17
53 0.16
54 0.15
55 0.14
56 0.13
57 0.12
58 0.11
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.06
72 0.06
73 0.07
74 0.08
75 0.1
76 0.14
77 0.15
78 0.16
79 0.15
80 0.14
81 0.19
82 0.23
83 0.24
84 0.25
85 0.25
86 0.26
87 0.26
88 0.26
89 0.26
90 0.26
91 0.31
92 0.34
93 0.4
94 0.44
95 0.52
96 0.62
97 0.69
98 0.74
99 0.76
100 0.79
101 0.82
102 0.86
103 0.86
104 0.81
105 0.74
106 0.67
107 0.58
108 0.47
109 0.37
110 0.27
111 0.19