Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TTZ6

Protein Details
Accession A0A1W2TTZ6   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-33NTDPWNKETKRKFQNKSKSEYFHydrophilic
62-87EAYRACKKEWINKRKEEKKKSGGFFSHydrophilic
NLS Segment(s)
PositionSequence
74-81KRKEEKKK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSTPADSNTDPNTDPWNKETKRKFQNKSKSEYFDPCQEAASKSIQCLNRNSGDRTMCGDYFEAYRACKKEWINKRKEEKKKSGGFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.39
4 0.38
5 0.46
6 0.53
7 0.55
8 0.62
9 0.7
10 0.75
11 0.75
12 0.84
13 0.81
14 0.81
15 0.78
16 0.73
17 0.68
18 0.65
19 0.58
20 0.53
21 0.5
22 0.42
23 0.35
24 0.31
25 0.27
26 0.22
27 0.23
28 0.16
29 0.14
30 0.19
31 0.21
32 0.22
33 0.24
34 0.26
35 0.28
36 0.31
37 0.32
38 0.32
39 0.3
40 0.29
41 0.3
42 0.3
43 0.24
44 0.22
45 0.2
46 0.16
47 0.16
48 0.18
49 0.15
50 0.13
51 0.18
52 0.2
53 0.21
54 0.26
55 0.3
56 0.38
57 0.47
58 0.57
59 0.6
60 0.68
61 0.77
62 0.82
63 0.88
64 0.89
65 0.88
66 0.88
67 0.89