Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8AA13

Protein Details
Accession A0A1S8AA13    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
108-129TIAPRGRMRFRRRDESRIRGSPBasic
NLS Segment(s)
PositionSequence
112-120RGRMRFRRR
Subcellular Location(s) plas 15, vacu 5, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005828  MFS_sugar_transport-like  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
GO:0008643  P:carbohydrate transport  
Pfam View protein in Pfam  
PF00083  Sugar_tr  
Amino Acid Sequences MVYSLGFGAINFFFALPAIRTIDTLGRRKWLVLTLPLMCLFLTGAALATAFIAHGTPARDGIVTLFIFLFAATYSPGLGTCCLGRGRRGLLILRRADPLHLGIGKLPTIAPRGRMRFRRRDESRIRGSPVYLLPNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.08
4 0.1
5 0.12
6 0.12
7 0.12
8 0.14
9 0.19
10 0.25
11 0.3
12 0.29
13 0.31
14 0.31
15 0.32
16 0.32
17 0.3
18 0.27
19 0.25
20 0.28
21 0.24
22 0.26
23 0.25
24 0.24
25 0.19
26 0.16
27 0.12
28 0.07
29 0.06
30 0.04
31 0.04
32 0.03
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.06
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.07
69 0.1
70 0.11
71 0.13
72 0.15
73 0.16
74 0.18
75 0.2
76 0.22
77 0.25
78 0.32
79 0.33
80 0.32
81 0.33
82 0.31
83 0.29
84 0.26
85 0.22
86 0.19
87 0.16
88 0.15
89 0.14
90 0.16
91 0.15
92 0.14
93 0.13
94 0.11
95 0.15
96 0.16
97 0.2
98 0.26
99 0.34
100 0.42
101 0.52
102 0.59
103 0.65
104 0.73
105 0.78
106 0.77
107 0.8
108 0.81
109 0.81
110 0.82
111 0.78
112 0.76
113 0.66
114 0.6
115 0.55
116 0.5