Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8A7H6

Protein Details
Accession A0A1S8A7H6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-25KKAHRNGIKKPK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLNGTDPKFRRNHRYALHGTMRALKEKQEGKRETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.84
9 0.82
10 0.81
11 0.83
12 0.83
13 0.81
14 0.78
15 0.74
16 0.7
17 0.66
18 0.63
19 0.57
20 0.5
21 0.45
22 0.46
23 0.4
24 0.39
25 0.42
26 0.39
27 0.44
28 0.47
29 0.53
30 0.47
31 0.55
32 0.53
33 0.56
34 0.58
35 0.51
36 0.48
37 0.47
38 0.45
39 0.42
40 0.38
41 0.33
42 0.35
43 0.4
44 0.47
45 0.5