Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W2TGQ1

Protein Details
Accession A0A1W2TGQ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71DGGKCPKKTTCKPINNLPYCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MQFLAIAALVATALAASTGLDARGAQCTPPSYACKPDNSGWLVCNVDGTWLDGGKCPKKTTCKPINNLPYCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.08
11 0.08
12 0.08
13 0.09
14 0.11
15 0.12
16 0.15
17 0.19
18 0.19
19 0.25
20 0.27
21 0.28
22 0.3
23 0.3
24 0.31
25 0.29
26 0.28
27 0.22
28 0.22
29 0.2
30 0.16
31 0.15
32 0.11
33 0.09
34 0.09
35 0.1
36 0.08
37 0.08
38 0.09
39 0.12
40 0.18
41 0.23
42 0.26
43 0.28
44 0.34
45 0.43
46 0.52
47 0.59
48 0.64
49 0.68
50 0.71
51 0.79
52 0.84