Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TUJ5

Protein Details
Accession A0A1W2TUJ5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPPTRRRTPSLQMQQRTRKERHFDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9.5, cyto_mito 6.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019236  APP1_cat  
Gene Ontology GO:0008195  F:phosphatidate phosphatase activity  
Pfam View protein in Pfam  
PF09949  APP1_cat  
Amino Acid Sequences MPPTRRRTPSLQMQQRTRKERHFDEAEKDLPGFPGVFSTVTTTLSTKDKLYTALSYLGKKNPIPRSVTASDMVWLLDNTAYRNAQTGLWEAEYVAAMFSQHTSNSIIEAIDSVADKINLEERDPAYKTLEDRLGPFVQDIKPGTQVKALYRGKSPMKLGPSGHNGISSDIKRLPGGRDGELVPTFARVPKGANGILEMKTFYAEAEGWGIISDIDDTIKITQTSDPIGILRSTFIDPPEPAPGMPELYRYIHSLVKETSAWFYLSASPYNLYPFLRDFRQNHFPHGTIILRDSSWMSVRGLLTTLTLGTEDYKVDRMEKIHSWLPRRKMICVGDSTQTDPEAYGEIYRRHPNWIKAILIRKVEDIAAIGIESKNEPERFEEAFKDVPRNVWHVFSDPETCRKVVEEVVGGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.83
5 0.81
6 0.8
7 0.78
8 0.77
9 0.76
10 0.71
11 0.69
12 0.68
13 0.61
14 0.53
15 0.48
16 0.39
17 0.31
18 0.26
19 0.2
20 0.13
21 0.13
22 0.12
23 0.12
24 0.11
25 0.15
26 0.15
27 0.16
28 0.17
29 0.16
30 0.17
31 0.21
32 0.22
33 0.19
34 0.21
35 0.21
36 0.22
37 0.24
38 0.24
39 0.22
40 0.28
41 0.29
42 0.31
43 0.35
44 0.37
45 0.39
46 0.39
47 0.46
48 0.47
49 0.49
50 0.5
51 0.48
52 0.52
53 0.5
54 0.5
55 0.43
56 0.35
57 0.3
58 0.25
59 0.22
60 0.14
61 0.12
62 0.1
63 0.1
64 0.1
65 0.11
66 0.14
67 0.14
68 0.14
69 0.16
70 0.16
71 0.15
72 0.16
73 0.17
74 0.15
75 0.16
76 0.16
77 0.14
78 0.13
79 0.12
80 0.11
81 0.08
82 0.06
83 0.05
84 0.05
85 0.07
86 0.07
87 0.07
88 0.08
89 0.1
90 0.1
91 0.11
92 0.12
93 0.1
94 0.09
95 0.1
96 0.08
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.13
105 0.12
106 0.13
107 0.17
108 0.17
109 0.23
110 0.24
111 0.25
112 0.22
113 0.24
114 0.24
115 0.24
116 0.27
117 0.22
118 0.23
119 0.26
120 0.24
121 0.22
122 0.22
123 0.21
124 0.18
125 0.21
126 0.2
127 0.17
128 0.23
129 0.24
130 0.24
131 0.23
132 0.25
133 0.23
134 0.32
135 0.33
136 0.29
137 0.29
138 0.35
139 0.35
140 0.36
141 0.37
142 0.32
143 0.32
144 0.34
145 0.33
146 0.33
147 0.35
148 0.34
149 0.31
150 0.28
151 0.25
152 0.23
153 0.26
154 0.21
155 0.18
156 0.17
157 0.18
158 0.17
159 0.18
160 0.18
161 0.2
162 0.22
163 0.19
164 0.2
165 0.2
166 0.22
167 0.21
168 0.2
169 0.14
170 0.12
171 0.12
172 0.11
173 0.11
174 0.08
175 0.1
176 0.11
177 0.15
178 0.14
179 0.14
180 0.14
181 0.16
182 0.16
183 0.15
184 0.13
185 0.1
186 0.1
187 0.09
188 0.07
189 0.06
190 0.05
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.04
204 0.04
205 0.06
206 0.06
207 0.06
208 0.07
209 0.08
210 0.09
211 0.09
212 0.09
213 0.08
214 0.09
215 0.08
216 0.08
217 0.07
218 0.08
219 0.09
220 0.09
221 0.1
222 0.11
223 0.11
224 0.13
225 0.15
226 0.14
227 0.12
228 0.13
229 0.13
230 0.12
231 0.12
232 0.12
233 0.12
234 0.13
235 0.14
236 0.14
237 0.16
238 0.16
239 0.17
240 0.18
241 0.16
242 0.17
243 0.16
244 0.16
245 0.15
246 0.14
247 0.14
248 0.11
249 0.12
250 0.13
251 0.14
252 0.14
253 0.14
254 0.13
255 0.13
256 0.15
257 0.16
258 0.12
259 0.12
260 0.14
261 0.16
262 0.19
263 0.25
264 0.27
265 0.32
266 0.42
267 0.41
268 0.45
269 0.45
270 0.42
271 0.37
272 0.38
273 0.32
274 0.23
275 0.24
276 0.19
277 0.15
278 0.16
279 0.15
280 0.13
281 0.13
282 0.14
283 0.12
284 0.14
285 0.15
286 0.14
287 0.14
288 0.13
289 0.11
290 0.1
291 0.1
292 0.06
293 0.06
294 0.06
295 0.07
296 0.08
297 0.08
298 0.09
299 0.12
300 0.12
301 0.14
302 0.16
303 0.16
304 0.2
305 0.22
306 0.26
307 0.29
308 0.34
309 0.4
310 0.46
311 0.5
312 0.54
313 0.53
314 0.5
315 0.54
316 0.52
317 0.49
318 0.46
319 0.43
320 0.4
321 0.4
322 0.4
323 0.33
324 0.29
325 0.24
326 0.19
327 0.17
328 0.13
329 0.12
330 0.12
331 0.15
332 0.18
333 0.24
334 0.31
335 0.31
336 0.38
337 0.44
338 0.47
339 0.51
340 0.52
341 0.51
342 0.51
343 0.59
344 0.56
345 0.54
346 0.5
347 0.43
348 0.39
349 0.35
350 0.29
351 0.21
352 0.15
353 0.11
354 0.1
355 0.1
356 0.09
357 0.1
358 0.1
359 0.12
360 0.18
361 0.19
362 0.2
363 0.23
364 0.27
365 0.3
366 0.33
367 0.33
368 0.3
369 0.35
370 0.37
371 0.38
372 0.35
373 0.37
374 0.37
375 0.4
376 0.37
377 0.35
378 0.34
379 0.32
380 0.34
381 0.32
382 0.36
383 0.34
384 0.39
385 0.39
386 0.37
387 0.35
388 0.34
389 0.33
390 0.29
391 0.3