Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8A701

Protein Details
Accession A0A1S8A701    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40HYCFWPTQRRSKPHPPRSASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MTSTQLRPVTFIKHRLPAPRHYCFWPTQRRSKPHPPRSASATGKARVAVLYQALNPPIINGVRKPRKPGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.56
4 0.58
5 0.6
6 0.58
7 0.56
8 0.53
9 0.53
10 0.49
11 0.53
12 0.54
13 0.52
14 0.57
15 0.62
16 0.65
17 0.69
18 0.76
19 0.78
20 0.77
21 0.81
22 0.74
23 0.69
24 0.69
25 0.69
26 0.6
27 0.56
28 0.51
29 0.43
30 0.4
31 0.37
32 0.3
33 0.22
34 0.21
35 0.14
36 0.11
37 0.1
38 0.11
39 0.12
40 0.13
41 0.13
42 0.12
43 0.11
44 0.13
45 0.14
46 0.15
47 0.18
48 0.29
49 0.38
50 0.42
51 0.5