Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8AA05

Protein Details
Accession A0A1S8AA05   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-37LWKTPWRLSRFQKARQRGRLRAHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATNALSGGLLWKTPWRLSRFQKARQRGRLRAVDAVVATVDQALAKKGETLKALEVWKETMPTEAEMLPKDKYTMFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.12
5 0.15
6 0.19
7 0.25
8 0.29
9 0.37
10 0.44
11 0.55
12 0.59
13 0.66
14 0.72
15 0.76
16 0.8
17 0.82
18 0.84
19 0.8
20 0.8
21 0.76
22 0.69
23 0.63
24 0.53
25 0.44
26 0.35
27 0.28
28 0.2
29 0.13
30 0.1
31 0.06
32 0.05
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.07
40 0.1
41 0.1
42 0.11
43 0.12
44 0.15
45 0.16
46 0.15
47 0.15
48 0.15
49 0.14
50 0.14
51 0.13
52 0.11
53 0.11
54 0.11
55 0.12
56 0.11
57 0.12
58 0.12
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.38
69 0.44
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79