Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8ABC0

Protein Details
Accession A0A1S8ABC0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
175-196NCDRSKLVKREKRNDDHPRIHYBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000845  Nucleoside_phosphorylase_d  
IPR035994  Nucleoside_phosphorylase_sf  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0009116  P:nucleoside metabolic process  
Pfam View protein in Pfam  
PF01048  PNP_UDP_1  
Amino Acid Sequences MLDEKHPQLPMGAGDNNNYSFGRIKNHNIVITSLPDDGYGKANAAFVALNMYRTFPSLQEFLMVGIAGGAPINADVRLGDVVVSTKIHEYDLGKALSEGRFEPTAIQLRPSQGLRMAVTALRADHESQPSRIPSILSQMAKDNQHMERYASRKPLQDNLFDSGYAHPESARSCDNCDRSKLVKREKRNDDHPRIHYGIIASGDQVIKSAETRDKLAKRCNALCFEMEAAGFTESLQCLVIRSICDYSDSHKNDQWQRYAAATAAAYTKELLCVMASPEVTKSRVDKGLYEKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.27
4 0.27
5 0.25
6 0.21
7 0.21
8 0.22
9 0.26
10 0.28
11 0.35
12 0.41
13 0.46
14 0.47
15 0.44
16 0.44
17 0.4
18 0.37
19 0.32
20 0.24
21 0.19
22 0.17
23 0.17
24 0.16
25 0.16
26 0.14
27 0.12
28 0.12
29 0.13
30 0.12
31 0.12
32 0.1
33 0.07
34 0.13
35 0.12
36 0.13
37 0.13
38 0.15
39 0.14
40 0.16
41 0.17
42 0.12
43 0.15
44 0.15
45 0.14
46 0.15
47 0.14
48 0.13
49 0.12
50 0.11
51 0.07
52 0.06
53 0.06
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.09
75 0.11
76 0.11
77 0.14
78 0.18
79 0.18
80 0.17
81 0.17
82 0.19
83 0.18
84 0.18
85 0.14
86 0.13
87 0.13
88 0.13
89 0.14
90 0.15
91 0.2
92 0.19
93 0.21
94 0.2
95 0.21
96 0.24
97 0.23
98 0.2
99 0.16
100 0.18
101 0.16
102 0.15
103 0.14
104 0.12
105 0.12
106 0.12
107 0.09
108 0.08
109 0.09
110 0.1
111 0.12
112 0.16
113 0.17
114 0.18
115 0.21
116 0.21
117 0.2
118 0.19
119 0.17
120 0.13
121 0.16
122 0.2
123 0.17
124 0.17
125 0.19
126 0.22
127 0.22
128 0.22
129 0.21
130 0.17
131 0.19
132 0.18
133 0.18
134 0.19
135 0.22
136 0.25
137 0.27
138 0.29
139 0.3
140 0.32
141 0.38
142 0.35
143 0.36
144 0.35
145 0.32
146 0.3
147 0.26
148 0.25
149 0.18
150 0.18
151 0.14
152 0.12
153 0.08
154 0.09
155 0.1
156 0.11
157 0.14
158 0.12
159 0.16
160 0.22
161 0.28
162 0.29
163 0.31
164 0.33
165 0.35
166 0.43
167 0.47
168 0.52
169 0.54
170 0.62
171 0.7
172 0.75
173 0.77
174 0.79
175 0.81
176 0.8
177 0.81
178 0.75
179 0.71
180 0.64
181 0.57
182 0.47
183 0.37
184 0.29
185 0.22
186 0.19
187 0.12
188 0.12
189 0.12
190 0.1
191 0.1
192 0.08
193 0.07
194 0.07
195 0.11
196 0.13
197 0.14
198 0.18
199 0.26
200 0.32
201 0.37
202 0.45
203 0.47
204 0.5
205 0.54
206 0.57
207 0.53
208 0.49
209 0.44
210 0.38
211 0.33
212 0.27
213 0.21
214 0.17
215 0.13
216 0.11
217 0.1
218 0.08
219 0.09
220 0.08
221 0.08
222 0.08
223 0.07
224 0.07
225 0.09
226 0.11
227 0.1
228 0.13
229 0.14
230 0.14
231 0.16
232 0.16
233 0.19
234 0.28
235 0.32
236 0.33
237 0.35
238 0.43
239 0.49
240 0.55
241 0.56
242 0.49
243 0.46
244 0.43
245 0.42
246 0.34
247 0.27
248 0.21
249 0.17
250 0.16
251 0.14
252 0.13
253 0.13
254 0.13
255 0.11
256 0.11
257 0.1
258 0.08
259 0.09
260 0.11
261 0.14
262 0.14
263 0.14
264 0.17
265 0.2
266 0.21
267 0.23
268 0.24
269 0.27
270 0.33
271 0.34
272 0.35
273 0.4