Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TGY9

Protein Details
Accession A0A1W2TGY9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
72-109REREMERKRERVREKEKKEKEKEKEKEKEKEKEKEKEEBasic
NLS Segment(s)
PositionSequence
67-107AREREREREMERKRERVREKEKKEKEKEKEKEKEKEKEKEK
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009865  Proacrosin-bd  
Gene Ontology GO:0031410  C:cytoplasmic vesicle  
Pfam View protein in Pfam  
PF07222  PBP_sp32  
Amino Acid Sequences MVEITLHSRYVSPVILSAALTELVGEYTVELNQNVYTIRSEKDFNMVDLLQSCERVSPRVEALQKLAREREREREMERKRERVREKEKKEKEKEKEKEKEKEKEKEKEEAMLGGADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.12
5 0.1
6 0.09
7 0.08
8 0.07
9 0.06
10 0.05
11 0.05
12 0.05
13 0.04
14 0.05
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.07
22 0.08
23 0.09
24 0.1
25 0.11
26 0.12
27 0.14
28 0.13
29 0.19
30 0.19
31 0.17
32 0.19
33 0.18
34 0.16
35 0.15
36 0.18
37 0.12
38 0.12
39 0.11
40 0.1
41 0.11
42 0.12
43 0.12
44 0.11
45 0.12
46 0.16
47 0.18
48 0.17
49 0.2
50 0.24
51 0.24
52 0.24
53 0.28
54 0.26
55 0.3
56 0.32
57 0.37
58 0.37
59 0.39
60 0.42
61 0.47
62 0.5
63 0.56
64 0.59
65 0.61
66 0.62
67 0.68
68 0.72
69 0.72
70 0.77
71 0.78
72 0.81
73 0.83
74 0.87
75 0.88
76 0.9
77 0.9
78 0.89
79 0.89
80 0.88
81 0.88
82 0.88
83 0.86
84 0.86
85 0.85
86 0.85
87 0.83
88 0.84
89 0.82
90 0.82
91 0.77
92 0.76
93 0.69
94 0.64
95 0.56
96 0.48
97 0.4