Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S7ULG0

Protein Details
Accession A0A1S7ULG0    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-43AKSARVKKSKKSSQTKFKVRCSKQHydrophilic
63-82PPGLQIKDVPKKNKKGKHTABasic
NLS Segment(s)
PositionSequence
24-30RVKKSKK
72-80PKKNKKGKH
Subcellular Location(s) nucl 22, cyto_nucl 16, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKRFIEICRRDDAKSARVKKSKKSSQTKFKVRCSKQLYTLILKDSDKAEKLKQSLPPGLQIKDVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.4
4 0.36
5 0.43
6 0.47
7 0.45
8 0.5
9 0.54
10 0.55
11 0.61
12 0.64
13 0.65
14 0.72
15 0.73
16 0.73
17 0.77
18 0.77
19 0.8
20 0.86
21 0.87
22 0.84
23 0.85
24 0.85
25 0.77
26 0.77
27 0.73
28 0.66
29 0.62
30 0.61
31 0.54
32 0.48
33 0.47
34 0.39
35 0.34
36 0.31
37 0.26
38 0.21
39 0.21
40 0.19
41 0.2
42 0.22
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.44
51 0.44
52 0.42
53 0.39
54 0.37
55 0.4
56 0.43
57 0.5
58 0.52
59 0.57
60 0.66
61 0.74
62 0.8