Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TRD9

Protein Details
Accession A0A1W2TRD9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-54TKTEVLPKTKTKNKNKNKNKNKTKTKTTTKAKTDHydrophilic
NLS Segment(s)
PositionSequence
28-46KTKTKNKNKNKNKNKTKTK
Subcellular Location(s) mito 18, cyto_nucl 5.5, nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKTQAPLKIDVKSYALLKINTKTEVLPKTKTKNKNKNKNKNKTKTKTTTKAKTDAIAPTSKLSFLMFPTLFPPISRGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.27
4 0.28
5 0.3
6 0.31
7 0.29
8 0.29
9 0.25
10 0.27
11 0.32
12 0.32
13 0.33
14 0.37
15 0.44
16 0.52
17 0.61
18 0.65
19 0.69
20 0.76
21 0.82
22 0.87
23 0.9
24 0.92
25 0.93
26 0.93
27 0.93
28 0.93
29 0.9
30 0.89
31 0.88
32 0.87
33 0.86
34 0.84
35 0.83
36 0.77
37 0.75
38 0.67
39 0.59
40 0.52
41 0.46
42 0.4
43 0.33
44 0.29
45 0.25
46 0.24
47 0.22
48 0.19
49 0.16
50 0.14
51 0.13
52 0.19
53 0.17
54 0.17
55 0.19
56 0.22
57 0.21
58 0.2