Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0C152

Protein Details
Accession A0A0D0C152    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPLSAKAWEKKHSRKRGNGSVLRRNPGHydrophilic
NLS Segment(s)
PositionSequence
10-26EKKHSRKRGNGSVLRRN
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPLSAKAWEKKHSRKRGNGSVLRRNPGRGDGSTWKSRGYICAAAVDGFSIDNVHDAEEYDASEAFTPVSFSRTFSLFDGVQLLPSKRQRKAKSRLGDFEILSSNPKVIPINDDCSDTDEDEWEKVDVLDISGGRRMTYSQVLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.86
4 0.88
5 0.89
6 0.87
7 0.86
8 0.85
9 0.82
10 0.79
11 0.71
12 0.63
13 0.54
14 0.51
15 0.46
16 0.36
17 0.36
18 0.38
19 0.42
20 0.45
21 0.44
22 0.39
23 0.36
24 0.35
25 0.31
26 0.28
27 0.25
28 0.19
29 0.2
30 0.2
31 0.19
32 0.18
33 0.15
34 0.1
35 0.06
36 0.06
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.05
56 0.07
57 0.07
58 0.08
59 0.1
60 0.11
61 0.12
62 0.11
63 0.14
64 0.12
65 0.12
66 0.14
67 0.12
68 0.13
69 0.13
70 0.14
71 0.16
72 0.23
73 0.29
74 0.32
75 0.41
76 0.48
77 0.56
78 0.65
79 0.69
80 0.72
81 0.73
82 0.73
83 0.69
84 0.64
85 0.54
86 0.47
87 0.39
88 0.3
89 0.26
90 0.2
91 0.16
92 0.12
93 0.13
94 0.12
95 0.11
96 0.16
97 0.18
98 0.23
99 0.24
100 0.26
101 0.25
102 0.28
103 0.29
104 0.24
105 0.21
106 0.17
107 0.17
108 0.16
109 0.16
110 0.13
111 0.11
112 0.1
113 0.12
114 0.09
115 0.09
116 0.11
117 0.11
118 0.12
119 0.16
120 0.16
121 0.14
122 0.15
123 0.15
124 0.17
125 0.23