Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C1Y3

Protein Details
Accession A0A0D0C1Y3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-124PLDLRPKKTRAIRRRLTKHEESLKTLKQKKKDIHFPIRKYAVKBasic
NLS Segment(s)
PositionSequence
85-119LRPKKTRAIRRRLTKHEESLKTLKQKKKDIHFPIR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPSSKVKAYELQSKSKNDLTKQLNELKTELLSLRVQKILGGSASKLTRINIVRKSIARVLTVMNQKQRQNLREFYKNKKFLPLDLRPKKTRAIRRRLTKHEESLKTLKQKKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.56
4 0.48
5 0.53
6 0.5
7 0.5
8 0.53
9 0.56
10 0.53
11 0.49
12 0.48
13 0.4
14 0.34
15 0.28
16 0.22
17 0.17
18 0.16
19 0.17
20 0.18
21 0.18
22 0.18
23 0.17
24 0.17
25 0.15
26 0.14
27 0.12
28 0.1
29 0.13
30 0.13
31 0.14
32 0.14
33 0.14
34 0.18
35 0.21
36 0.27
37 0.27
38 0.3
39 0.33
40 0.33
41 0.36
42 0.34
43 0.32
44 0.26
45 0.22
46 0.2
47 0.23
48 0.27
49 0.26
50 0.28
51 0.31
52 0.32
53 0.37
54 0.41
55 0.39
56 0.39
57 0.43
58 0.44
59 0.49
60 0.52
61 0.56
62 0.61
63 0.62
64 0.58
65 0.6
66 0.55
67 0.51
68 0.55
69 0.55
70 0.56
71 0.6
72 0.66
73 0.61
74 0.62
75 0.64
76 0.64
77 0.65
78 0.64
79 0.66
80 0.68
81 0.76
82 0.83
83 0.85
84 0.85
85 0.82
86 0.81
87 0.8
88 0.74
89 0.7
90 0.68
91 0.66
92 0.67
93 0.69
94 0.66
95 0.65
96 0.7
97 0.72
98 0.75
99 0.79
100 0.79
101 0.82
102 0.85
103 0.82
104 0.83
105 0.83