Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B3V6

Protein Details
Accession A0A0D0B3V6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-91REFDDRFRKRGKRHQPDTSSBasic
NLS Segment(s)
PositionSequence
78-84FRKRGKR
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MTASPQPYSGYAFPIMATSPSTSLPGASSKVPPKPKPVNVFSNDGSFLERFQRSKKDQEDKRKAEEALARQREFDDRFRKRGKRHQPDTSSTVTQGQPTKKVKVDSATSCIVMVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.12
4 0.13
5 0.11
6 0.11
7 0.11
8 0.13
9 0.12
10 0.12
11 0.12
12 0.13
13 0.13
14 0.14
15 0.19
16 0.22
17 0.3
18 0.38
19 0.39
20 0.46
21 0.53
22 0.59
23 0.61
24 0.62
25 0.63
26 0.58
27 0.61
28 0.52
29 0.46
30 0.39
31 0.31
32 0.27
33 0.19
34 0.16
35 0.16
36 0.17
37 0.16
38 0.18
39 0.25
40 0.27
41 0.35
42 0.42
43 0.47
44 0.53
45 0.63
46 0.71
47 0.68
48 0.69
49 0.65
50 0.57
51 0.51
52 0.48
53 0.44
54 0.44
55 0.46
56 0.41
57 0.38
58 0.39
59 0.39
60 0.38
61 0.38
62 0.39
63 0.38
64 0.45
65 0.54
66 0.6
67 0.63
68 0.71
69 0.74
70 0.75
71 0.79
72 0.81
73 0.8
74 0.79
75 0.76
76 0.71
77 0.61
78 0.52
79 0.47
80 0.38
81 0.35
82 0.35
83 0.34
84 0.37
85 0.4
86 0.45
87 0.45
88 0.47
89 0.47
90 0.47
91 0.51
92 0.48
93 0.48
94 0.45
95 0.41