Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C390

Protein Details
Accession A0A0D0C390    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
97-125GKTKVEKKVKAPKSPKKEKKKEELKEEAABasic
NLS Segment(s)
PositionSequence
77-121KEERPKSPSLLAKLLAPFKEGKTKVEKKVKAPKSPKKEKKKEELK
191-213KEEKEEKKEKENKAAKVGRRLSA
Subcellular Location(s) cyto 16.5, cyto_nucl 13.333, nucl 9, mito_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MSATEATAVPVPAEEVKVVETPAVDPAPEAAAVEEPAPATEAPKEEVKAEEAATAAEPAPEAAADAAKEETKTEVKKEERPKSPSLLAKLLAPFKEGKTKVEKKVKAPKSPKKEKKKEELKEEAAPPAEEPAKEEAPAAEAKVEETPAVAEPAAEEPAPEPVKETETAAPEAPAAEPAAEPAPETPAEAPKEEKEEKKEKENKAAKVGRRLSARVGDLFRSKPKTELSTPAKVDEHPPVIDEPAPVAPLENPASSEPAPAAAPAAEEPVPAEPALAATPVISAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.12
4 0.13
5 0.13
6 0.12
7 0.11
8 0.11
9 0.15
10 0.14
11 0.12
12 0.11
13 0.12
14 0.12
15 0.12
16 0.11
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.09
27 0.11
28 0.12
29 0.14
30 0.17
31 0.18
32 0.18
33 0.19
34 0.2
35 0.19
36 0.18
37 0.16
38 0.13
39 0.13
40 0.12
41 0.11
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.06
53 0.07
54 0.08
55 0.08
56 0.09
57 0.12
58 0.16
59 0.18
60 0.2
61 0.27
62 0.31
63 0.39
64 0.49
65 0.55
66 0.59
67 0.63
68 0.64
69 0.61
70 0.63
71 0.6
72 0.54
73 0.48
74 0.4
75 0.37
76 0.37
77 0.35
78 0.28
79 0.25
80 0.22
81 0.2
82 0.29
83 0.27
84 0.27
85 0.33
86 0.4
87 0.48
88 0.56
89 0.59
90 0.59
91 0.69
92 0.73
93 0.73
94 0.77
95 0.77
96 0.78
97 0.85
98 0.86
99 0.87
100 0.89
101 0.87
102 0.88
103 0.89
104 0.86
105 0.83
106 0.82
107 0.75
108 0.7
109 0.63
110 0.54
111 0.44
112 0.36
113 0.27
114 0.21
115 0.18
116 0.12
117 0.13
118 0.14
119 0.14
120 0.14
121 0.14
122 0.11
123 0.12
124 0.12
125 0.1
126 0.07
127 0.06
128 0.07
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.05
137 0.04
138 0.05
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.11
145 0.11
146 0.11
147 0.12
148 0.12
149 0.14
150 0.14
151 0.16
152 0.13
153 0.15
154 0.17
155 0.15
156 0.14
157 0.13
158 0.13
159 0.11
160 0.08
161 0.06
162 0.05
163 0.05
164 0.06
165 0.07
166 0.06
167 0.06
168 0.06
169 0.08
170 0.08
171 0.09
172 0.09
173 0.13
174 0.14
175 0.15
176 0.17
177 0.17
178 0.24
179 0.27
180 0.3
181 0.33
182 0.41
183 0.43
184 0.52
185 0.59
186 0.57
187 0.63
188 0.67
189 0.63
190 0.64
191 0.68
192 0.63
193 0.64
194 0.64
195 0.59
196 0.55
197 0.53
198 0.47
199 0.45
200 0.42
201 0.36
202 0.34
203 0.32
204 0.32
205 0.34
206 0.36
207 0.37
208 0.36
209 0.35
210 0.37
211 0.4
212 0.4
213 0.46
214 0.46
215 0.49
216 0.49
217 0.5
218 0.47
219 0.41
220 0.41
221 0.38
222 0.34
223 0.26
224 0.26
225 0.23
226 0.24
227 0.24
228 0.21
229 0.17
230 0.14
231 0.14
232 0.13
233 0.12
234 0.11
235 0.14
236 0.17
237 0.15
238 0.16
239 0.16
240 0.21
241 0.2
242 0.21
243 0.16
244 0.15
245 0.15
246 0.13
247 0.13
248 0.09
249 0.1
250 0.09
251 0.13
252 0.11
253 0.11
254 0.12
255 0.12
256 0.14
257 0.12
258 0.12
259 0.08
260 0.1
261 0.1
262 0.1
263 0.08
264 0.07
265 0.07