Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BQ48

Protein Details
Accession A0A0D0BQ48    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-62FFNQSDCRRHERSRKRHKGLPFAEHydrophilic
NLS Segment(s)
PositionSequence
50-56RSRKRHK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MCDECGQTFTAVFSLKRHMQSHTGVRPFACGIPGCNQAFFNQSDCRRHERSRKRHKGLPFAESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.28
4 0.29
5 0.3
6 0.32
7 0.37
8 0.44
9 0.45
10 0.43
11 0.38
12 0.37
13 0.35
14 0.32
15 0.27
16 0.2
17 0.12
18 0.11
19 0.14
20 0.19
21 0.18
22 0.18
23 0.18
24 0.17
25 0.19
26 0.18
27 0.18
28 0.2
29 0.24
30 0.29
31 0.33
32 0.39
33 0.43
34 0.5
35 0.58
36 0.62
37 0.69
38 0.75
39 0.83
40 0.84
41 0.84
42 0.85
43 0.85
44 0.8