Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0B1P4

Protein Details
Accession A0A0D0B1P4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-30APPISAKGGKRKYRQFLRERKLETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR041577  RT_RNaseH_2  
Pfam View protein in Pfam  
PF17919  RT_RNaseH_2  
Amino Acid Sequences MLRNLDAPPISAKGGKRKYRQFLRERKLETFWEQRHTRAFLKLKQILLTEPVLKAPTFDGTPFIVISDGCKDGFGAVLAQRFPFKEVSGEVVTKVHPIAFASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.55
4 0.62
5 0.71
6 0.77
7 0.83
8 0.83
9 0.85
10 0.84
11 0.84
12 0.8
13 0.73
14 0.66
15 0.61
16 0.57
17 0.55
18 0.5
19 0.49
20 0.45
21 0.44
22 0.44
23 0.44
24 0.39
25 0.38
26 0.4
27 0.37
28 0.44
29 0.46
30 0.43
31 0.4
32 0.39
33 0.31
34 0.28
35 0.25
36 0.17
37 0.13
38 0.13
39 0.12
40 0.11
41 0.11
42 0.09
43 0.09
44 0.08
45 0.08
46 0.09
47 0.09
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.08
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.08
62 0.07
63 0.08
64 0.1
65 0.11
66 0.12
67 0.13
68 0.14
69 0.15
70 0.15
71 0.14
72 0.14
73 0.15
74 0.2
75 0.22
76 0.22
77 0.21
78 0.21
79 0.21
80 0.19
81 0.19
82 0.14
83 0.11