Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZP93

Protein Details
Accession A0A0C9ZP93    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
217-245DGAWRNETEPRRTRKRRRTKAMVIQLLQRHydrophilic
NLS Segment(s)
PositionSequence
227-236RRTRKRRRTK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSTILSSSETTNNSPTPISPFSNYSVASDATSDESPDLGAFTTVFRALNHLQPLVPPRGGAYIYPELDTPSTDPGPLSSLPTDSEFIEGSTVWNQSMLASYLASSSSSHTRSTMTSMTASPHLPNPDNNFDESGEETEGELEPLTFTFTTPSRSQSHHSEISDADLSHDYSFSDGDIDLWDQPSLGDLGGVFSFLAAERARIAACDRCTGKDSSTSDGAWRNETEPRRTRKRRRTKAMVIQLLQRDREKCGTGEYESYHRNQHNTGYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.25
4 0.27
5 0.28
6 0.27
7 0.29
8 0.31
9 0.35
10 0.34
11 0.29
12 0.27
13 0.24
14 0.22
15 0.19
16 0.16
17 0.16
18 0.15
19 0.14
20 0.12
21 0.11
22 0.11
23 0.1
24 0.1
25 0.06
26 0.06
27 0.06
28 0.06
29 0.08
30 0.09
31 0.09
32 0.09
33 0.14
34 0.16
35 0.21
36 0.23
37 0.23
38 0.22
39 0.24
40 0.29
41 0.28
42 0.26
43 0.2
44 0.19
45 0.2
46 0.21
47 0.18
48 0.19
49 0.21
50 0.21
51 0.22
52 0.21
53 0.2
54 0.2
55 0.2
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.12
62 0.15
63 0.14
64 0.15
65 0.12
66 0.12
67 0.13
68 0.15
69 0.16
70 0.13
71 0.14
72 0.11
73 0.11
74 0.1
75 0.09
76 0.09
77 0.1
78 0.1
79 0.08
80 0.08
81 0.08
82 0.08
83 0.09
84 0.08
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.12
94 0.13
95 0.13
96 0.14
97 0.15
98 0.15
99 0.18
100 0.17
101 0.14
102 0.14
103 0.14
104 0.15
105 0.15
106 0.15
107 0.13
108 0.14
109 0.16
110 0.15
111 0.18
112 0.21
113 0.25
114 0.25
115 0.25
116 0.24
117 0.21
118 0.21
119 0.19
120 0.15
121 0.1
122 0.09
123 0.08
124 0.07
125 0.07
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.05
132 0.04
133 0.05
134 0.06
135 0.07
136 0.11
137 0.12
138 0.16
139 0.18
140 0.2
141 0.24
142 0.28
143 0.33
144 0.34
145 0.33
146 0.31
147 0.28
148 0.29
149 0.27
150 0.21
151 0.17
152 0.13
153 0.13
154 0.12
155 0.12
156 0.09
157 0.08
158 0.08
159 0.06
160 0.06
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.08
167 0.08
168 0.07
169 0.07
170 0.07
171 0.06
172 0.05
173 0.05
174 0.04
175 0.05
176 0.05
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.07
183 0.06
184 0.06
185 0.07
186 0.08
187 0.08
188 0.09
189 0.12
190 0.15
191 0.16
192 0.22
193 0.23
194 0.25
195 0.29
196 0.3
197 0.29
198 0.31
199 0.31
200 0.3
201 0.31
202 0.29
203 0.29
204 0.34
205 0.34
206 0.29
207 0.28
208 0.25
209 0.31
210 0.35
211 0.41
212 0.43
213 0.51
214 0.59
215 0.69
216 0.78
217 0.82
218 0.88
219 0.9
220 0.92
221 0.94
222 0.93
223 0.93
224 0.93
225 0.91
226 0.82
227 0.78
228 0.75
229 0.68
230 0.61
231 0.56
232 0.47
233 0.43
234 0.45
235 0.41
236 0.34
237 0.35
238 0.35
239 0.33
240 0.35
241 0.34
242 0.36
243 0.36
244 0.38
245 0.4
246 0.4
247 0.4
248 0.38