Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H201

Protein Details
Accession C6H201   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
154-179LNDSLDKGLRKRKRRFRWISRVGFVMHydrophilic
NLS Segment(s)
PositionSequence
162-170LRKRKRRFR
Subcellular Location(s) plas 13, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038769  MTC4  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVATRNWSISRSIDGPYRIDRREIARVRAHLLSSGIKALEICRQADMIRDSPPVLVFSTEHGLGGNVPRVPRSEEVTTAAWSLMFKFDREVCQVQHAMSKFSSSTSPSFKSRLDDLDSLVTSTLNPRIRELTSEADKLTSELATTNTLALKQLNDSLDKGLRKRKRRFRWISRVGFVMLEWVLVGAMWWLWLVVMIFKIFRGLWRGSVSGIRWILWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.32
4 0.37
5 0.42
6 0.38
7 0.39
8 0.4
9 0.4
10 0.48
11 0.49
12 0.49
13 0.49
14 0.49
15 0.51
16 0.5
17 0.45
18 0.36
19 0.33
20 0.29
21 0.23
22 0.22
23 0.18
24 0.15
25 0.15
26 0.14
27 0.18
28 0.17
29 0.17
30 0.16
31 0.17
32 0.17
33 0.22
34 0.24
35 0.2
36 0.21
37 0.21
38 0.21
39 0.21
40 0.22
41 0.18
42 0.14
43 0.13
44 0.11
45 0.12
46 0.14
47 0.13
48 0.12
49 0.11
50 0.11
51 0.1
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.14
58 0.17
59 0.18
60 0.21
61 0.2
62 0.2
63 0.23
64 0.24
65 0.23
66 0.2
67 0.18
68 0.13
69 0.11
70 0.1
71 0.11
72 0.1
73 0.1
74 0.11
75 0.13
76 0.15
77 0.2
78 0.21
79 0.17
80 0.2
81 0.21
82 0.19
83 0.22
84 0.2
85 0.17
86 0.15
87 0.16
88 0.12
89 0.12
90 0.13
91 0.11
92 0.13
93 0.15
94 0.18
95 0.19
96 0.22
97 0.21
98 0.23
99 0.22
100 0.23
101 0.23
102 0.21
103 0.2
104 0.2
105 0.19
106 0.17
107 0.15
108 0.12
109 0.08
110 0.09
111 0.14
112 0.16
113 0.16
114 0.17
115 0.2
116 0.2
117 0.22
118 0.24
119 0.24
120 0.23
121 0.24
122 0.22
123 0.2
124 0.2
125 0.18
126 0.16
127 0.1
128 0.07
129 0.06
130 0.07
131 0.08
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.1
138 0.09
139 0.09
140 0.12
141 0.13
142 0.14
143 0.14
144 0.17
145 0.21
146 0.23
147 0.27
148 0.33
149 0.41
150 0.5
151 0.59
152 0.67
153 0.73
154 0.82
155 0.88
156 0.9
157 0.92
158 0.93
159 0.9
160 0.82
161 0.74
162 0.63
163 0.52
164 0.41
165 0.33
166 0.22
167 0.13
168 0.1
169 0.08
170 0.06
171 0.06
172 0.06
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.05
182 0.07
183 0.08
184 0.08
185 0.08
186 0.11
187 0.1
188 0.12
189 0.16
190 0.17
191 0.21
192 0.24
193 0.25
194 0.25
195 0.3
196 0.29
197 0.32
198 0.31