Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z851

Protein Details
Accession A0A0C9Z851    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-132MRMFKSHLTKLRKKLNVRCRPPHYCLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences QGKYPKWAKDNAFLSKLPGDIAAEKMKAARAQETLNAHMTERKLSERVVPYSDQLFRKAAIEWLIATDQPIQALEHPRFKEMVDVASRATQGVKIPGRKATCAEIMRMFKSHLTKLRKKLNVRCRPPHYCLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.39
4 0.3
5 0.23
6 0.18
7 0.15
8 0.19
9 0.18
10 0.17
11 0.17
12 0.17
13 0.19
14 0.19
15 0.19
16 0.18
17 0.17
18 0.18
19 0.23
20 0.25
21 0.26
22 0.27
23 0.26
24 0.23
25 0.24
26 0.23
27 0.21
28 0.19
29 0.19
30 0.17
31 0.18
32 0.24
33 0.25
34 0.26
35 0.27
36 0.26
37 0.25
38 0.27
39 0.31
40 0.26
41 0.23
42 0.22
43 0.19
44 0.19
45 0.18
46 0.16
47 0.13
48 0.12
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.07
58 0.06
59 0.08
60 0.14
61 0.15
62 0.21
63 0.21
64 0.22
65 0.22
66 0.22
67 0.23
68 0.19
69 0.21
70 0.16
71 0.16
72 0.16
73 0.17
74 0.17
75 0.14
76 0.14
77 0.1
78 0.1
79 0.16
80 0.21
81 0.23
82 0.25
83 0.31
84 0.33
85 0.33
86 0.35
87 0.31
88 0.34
89 0.32
90 0.33
91 0.33
92 0.35
93 0.35
94 0.35
95 0.32
96 0.29
97 0.32
98 0.35
99 0.37
100 0.43
101 0.5
102 0.58
103 0.67
104 0.72
105 0.77
106 0.8
107 0.83
108 0.84
109 0.86
110 0.87
111 0.86
112 0.85