Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z5E0

Protein Details
Accession A0A0C9Z5E0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
110-130LTLLCRKARRIRRRGEADIFKHydrophilic
NLS Segment(s)
PositionSequence
118-122RRIRR
Subcellular Location(s) cyto_nucl 13.5, nucl 11.5, cyto 10.5, pero 2
Family & Domain DBs
Amino Acid Sequences MGGGVCNSYNTTEEKNNHSTDLRSANDERRTHKYEQPPPKSDLSPPKTNTEDPTPTSTPTQAIVSAGAMGSAVAKRLVHGGCTIYTNLDGRSPTANQRALDVGMINVHLLTLLCRKARRIRRRGEADIFKGFAKVFERVAGSLEGDRKDVETLKTGVEKALELQGMSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.4
4 0.42
5 0.41
6 0.37
7 0.35
8 0.39
9 0.33
10 0.33
11 0.36
12 0.4
13 0.46
14 0.48
15 0.48
16 0.49
17 0.53
18 0.52
19 0.56
20 0.59
21 0.61
22 0.68
23 0.72
24 0.69
25 0.67
26 0.67
27 0.61
28 0.58
29 0.59
30 0.55
31 0.54
32 0.52
33 0.53
34 0.52
35 0.52
36 0.49
37 0.45
38 0.42
39 0.36
40 0.4
41 0.36
42 0.34
43 0.33
44 0.3
45 0.24
46 0.21
47 0.19
48 0.12
49 0.11
50 0.1
51 0.08
52 0.08
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.12
70 0.11
71 0.08
72 0.09
73 0.09
74 0.08
75 0.09
76 0.08
77 0.08
78 0.1
79 0.11
80 0.15
81 0.2
82 0.23
83 0.21
84 0.22
85 0.22
86 0.2
87 0.19
88 0.15
89 0.1
90 0.07
91 0.07
92 0.06
93 0.04
94 0.04
95 0.04
96 0.03
97 0.05
98 0.08
99 0.11
100 0.14
101 0.15
102 0.2
103 0.29
104 0.4
105 0.5
106 0.56
107 0.62
108 0.7
109 0.77
110 0.81
111 0.8
112 0.77
113 0.72
114 0.66
115 0.58
116 0.48
117 0.4
118 0.33
119 0.26
120 0.21
121 0.18
122 0.15
123 0.16
124 0.18
125 0.17
126 0.19
127 0.17
128 0.16
129 0.17
130 0.21
131 0.19
132 0.18
133 0.18
134 0.18
135 0.19
136 0.21
137 0.19
138 0.2
139 0.2
140 0.22
141 0.25
142 0.24
143 0.23
144 0.21
145 0.2
146 0.17
147 0.21
148 0.18