Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H4Y8

Protein Details
Accession C6H4Y8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
51-75SSLSSTPKKEKPRAKISKRAKTTDAHydrophilic
NLS Segment(s)
PositionSequence
58-71KKEKPRAKISKRAK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MEVVGLYDINLNAICLQVSVLPLRISGRCSSTLANPSNYPLLALENALQISSLSSTPKKEKPRAKISKRAKTTDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.06
4 0.06
5 0.07
6 0.08
7 0.09
8 0.09
9 0.1
10 0.12
11 0.12
12 0.14
13 0.14
14 0.16
15 0.16
16 0.17
17 0.18
18 0.2
19 0.26
20 0.26
21 0.26
22 0.24
23 0.23
24 0.23
25 0.21
26 0.17
27 0.11
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.05
37 0.06
38 0.06
39 0.06
40 0.09
41 0.11
42 0.15
43 0.21
44 0.29
45 0.38
46 0.46
47 0.55
48 0.62
49 0.71
50 0.78
51 0.81
52 0.85
53 0.86
54 0.88
55 0.87
56 0.83