Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0AE31

Protein Details
Accession A0A0D0AE31    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-97SPTSRSYRKGIHKVPKWTRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTSVNLGGLLWKTPWKLSITRKANARARLKKVDAVIETVRASGIQCGALERALQLPKEHEMDPKDKYTVFSPTSRSYRKGIHKVPKWTRLTLRVNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.15
5 0.15
6 0.15
7 0.17
8 0.18
9 0.25
10 0.32
11 0.42
12 0.45
13 0.49
14 0.54
15 0.6
16 0.63
17 0.65
18 0.67
19 0.65
20 0.66
21 0.69
22 0.65
23 0.6
24 0.55
25 0.51
26 0.41
27 0.36
28 0.3
29 0.25
30 0.22
31 0.19
32 0.17
33 0.12
34 0.11
35 0.07
36 0.07
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.09
45 0.09
46 0.1
47 0.1
48 0.12
49 0.14
50 0.17
51 0.17
52 0.18
53 0.2
54 0.24
55 0.26
56 0.27
57 0.26
58 0.24
59 0.25
60 0.23
61 0.26
62 0.25
63 0.25
64 0.28
65 0.33
66 0.4
67 0.42
68 0.43
69 0.4
70 0.46
71 0.53
72 0.58
73 0.61
74 0.64
75 0.69
76 0.77
77 0.82
78 0.83
79 0.78
80 0.76
81 0.73
82 0.72
83 0.73
84 0.7
85 0.72