Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B4D5

Protein Details
Accession A0A0D0B4D5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-56ATFKNAKVRTDRRRGSRRQPTDPTSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 7, cyto 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MALTSLCHLHSLSISLTLTGTVTQPTIHTTATFKNAKVRTDRRRGSRRQPTDPTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.1
5 0.1
6 0.08
7 0.08
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.09
14 0.09
15 0.09
16 0.1
17 0.12
18 0.18
19 0.2
20 0.18
21 0.25
22 0.28
23 0.31
24 0.39
25 0.47
26 0.5
27 0.59
28 0.66
29 0.68
30 0.75
31 0.81
32 0.83
33 0.85
34 0.84
35 0.83
36 0.85