Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZPM6

Protein Details
Accession A0A0C9ZPM6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
26-46CDLAARTPRKQRRKQVTDIMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MIEVHTAMDIKISHDYMISQGTPHFCDLAARTPRKQRRKQVTDIMTSCSNFPDVQTSCIRWFADQNLLDFLFVLEHRVNYLYRPIKGRSNICHHHADFGDTGVEWYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.16
5 0.14
6 0.11
7 0.13
8 0.15
9 0.16
10 0.17
11 0.15
12 0.12
13 0.14
14 0.16
15 0.23
16 0.29
17 0.31
18 0.35
19 0.45
20 0.55
21 0.64
22 0.71
23 0.72
24 0.75
25 0.78
26 0.81
27 0.81
28 0.77
29 0.74
30 0.66
31 0.59
32 0.5
33 0.43
34 0.35
35 0.26
36 0.21
37 0.13
38 0.12
39 0.14
40 0.12
41 0.15
42 0.17
43 0.18
44 0.18
45 0.21
46 0.21
47 0.16
48 0.16
49 0.15
50 0.21
51 0.2
52 0.2
53 0.2
54 0.2
55 0.19
56 0.18
57 0.15
58 0.09
59 0.08
60 0.1
61 0.08
62 0.08
63 0.09
64 0.11
65 0.11
66 0.11
67 0.2
68 0.22
69 0.24
70 0.29
71 0.31
72 0.38
73 0.45
74 0.5
75 0.49
76 0.54
77 0.57
78 0.57
79 0.63
80 0.55
81 0.55
82 0.49
83 0.44
84 0.35
85 0.3
86 0.27
87 0.18