Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AF30

Protein Details
Accession A0A0D0AF30    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
121-143VQTVIQQPERPRRERRNVPGAGRHydrophilic
NLS Segment(s)
PositionSequence
133-136RERR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001210  Ribosomal_S17e  
IPR018273  Ribosomal_S17e_CS  
IPR036401  RPS17e-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00833  Ribosomal_S17e  
PROSITE View protein in PROSITE  
PS00712  RIBOSOMAL_S17E  
Amino Acid Sequences MGRVRTKTTKRAARVLIEKYYPRLTLDFHTNKRIIDEVAVVPSKRLRNKVSGFTTHLMKRIQRGPVRGISFKLQEEERERKDNYVPEVSALDTSATGLEIDKDTSELLKALNFDSIAVTIVQTVIQQPERPRRERRNVPGAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.62
4 0.58
5 0.55
6 0.51
7 0.49
8 0.41
9 0.35
10 0.31
11 0.27
12 0.26
13 0.34
14 0.38
15 0.38
16 0.44
17 0.43
18 0.42
19 0.42
20 0.39
21 0.29
22 0.22
23 0.21
24 0.15
25 0.17
26 0.19
27 0.17
28 0.17
29 0.21
30 0.25
31 0.27
32 0.31
33 0.3
34 0.37
35 0.42
36 0.49
37 0.49
38 0.47
39 0.47
40 0.44
41 0.46
42 0.38
43 0.38
44 0.32
45 0.28
46 0.29
47 0.3
48 0.35
49 0.33
50 0.35
51 0.34
52 0.38
53 0.41
54 0.37
55 0.34
56 0.29
57 0.28
58 0.25
59 0.23
60 0.17
61 0.18
62 0.23
63 0.27
64 0.28
65 0.31
66 0.32
67 0.32
68 0.35
69 0.34
70 0.32
71 0.29
72 0.25
73 0.21
74 0.22
75 0.2
76 0.17
77 0.14
78 0.1
79 0.06
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.1
99 0.1
100 0.09
101 0.1
102 0.1
103 0.09
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.11
112 0.13
113 0.18
114 0.25
115 0.36
116 0.44
117 0.5
118 0.59
119 0.65
120 0.74
121 0.81
122 0.83
123 0.83