Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BJA3

Protein Details
Accession A0A0D0BJA3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
9-28RSASCAKRPGTRRRPLKFQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MLRRPHELRSASCAKRPGTRRRPLKFQTATTQQGLCSPNQTYLLSSPISTPCGKCLLCQLRQDSGTKCWMVVYLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.56
4 0.59
5 0.6
6 0.67
7 0.72
8 0.73
9 0.81
10 0.76
11 0.78
12 0.72
13 0.66
14 0.64
15 0.6
16 0.57
17 0.49
18 0.46
19 0.35
20 0.34
21 0.31
22 0.23
23 0.19
24 0.16
25 0.15
26 0.17
27 0.17
28 0.13
29 0.12
30 0.14
31 0.12
32 0.12
33 0.12
34 0.12
35 0.15
36 0.15
37 0.15
38 0.14
39 0.2
40 0.2
41 0.18
42 0.28
43 0.32
44 0.36
45 0.42
46 0.44
47 0.44
48 0.47
49 0.5
50 0.44
51 0.4
52 0.41
53 0.35
54 0.31
55 0.26