Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A074

Protein Details
Accession A0A0D0A074    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNPDQQPPEKRRRGRPKGSKNGPNAGTHydrophilic
NLS Segment(s)
PositionSequence
9-37EKRRRGRPKGSKNGPNAGTTGRPVGRPRK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNPDQQPPEKRRRGRPKGSKNGPNAGTTGRPVGRPRKDGSVRVPTATAPSRSTTAGAEVHNSDTSPQPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.9
4 0.92
5 0.93
6 0.9
7 0.85
8 0.82
9 0.73
10 0.63
11 0.53
12 0.44
13 0.35
14 0.27
15 0.25
16 0.18
17 0.18
18 0.21
19 0.29
20 0.32
21 0.34
22 0.35
23 0.41
24 0.43
25 0.45
26 0.48
27 0.48
28 0.45
29 0.42
30 0.41
31 0.31
32 0.33
33 0.32
34 0.28
35 0.2
36 0.21
37 0.21
38 0.22
39 0.22
40 0.18
41 0.18
42 0.18
43 0.17
44 0.18
45 0.18
46 0.2
47 0.2
48 0.19
49 0.18
50 0.19