Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZTQ3

Protein Details
Accession A0A0C9ZTQ3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
30-51FESCHARKTRKLRVQRVQNYISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.833, nucl 4
Family & Domain DBs
Amino Acid Sequences MKRVSKSFTTVRHSLYRSLSTSSREVKMSFESCHARKTRKLRVQRVQNYISLCMPRTTSYLARIRGTLTRTGAGKPLKSHLPADDWVRVPPGSTHVTCNLGSTWIFQASTANLLVSGFAFPDAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.46
4 0.41
5 0.41
6 0.39
7 0.35
8 0.39
9 0.38
10 0.36
11 0.33
12 0.31
13 0.29
14 0.32
15 0.31
16 0.27
17 0.27
18 0.32
19 0.31
20 0.38
21 0.4
22 0.39
23 0.43
24 0.51
25 0.57
26 0.59
27 0.68
28 0.71
29 0.76
30 0.83
31 0.84
32 0.82
33 0.73
34 0.67
35 0.59
36 0.5
37 0.42
38 0.32
39 0.24
40 0.18
41 0.16
42 0.14
43 0.14
44 0.15
45 0.15
46 0.19
47 0.24
48 0.25
49 0.25
50 0.24
51 0.24
52 0.24
53 0.25
54 0.22
55 0.18
56 0.17
57 0.18
58 0.18
59 0.22
60 0.21
61 0.21
62 0.2
63 0.22
64 0.24
65 0.25
66 0.25
67 0.22
68 0.23
69 0.24
70 0.26
71 0.28
72 0.25
73 0.24
74 0.24
75 0.22
76 0.19
77 0.17
78 0.18
79 0.19
80 0.19
81 0.21
82 0.22
83 0.25
84 0.24
85 0.25
86 0.21
87 0.18
88 0.17
89 0.17
90 0.16
91 0.15
92 0.15
93 0.13
94 0.15
95 0.14
96 0.16
97 0.14
98 0.11
99 0.1
100 0.1
101 0.1
102 0.09
103 0.08
104 0.06