Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BRB4

Protein Details
Accession Q6BRB4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPTEKKRTTRKKKDPDAPKRSLSBasic
NLS Segment(s)
PositionSequence
6-18KKRTTRKKKDPDA
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG dha:DEHA2D17710g  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAPTEKKRTTRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALTPEDKIPYENKADTDKKRYEKEKAEYAKKNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.92
5 0.87
6 0.8
7 0.72
8 0.63
9 0.58
10 0.49
11 0.4
12 0.34
13 0.29
14 0.26
15 0.23
16 0.23
17 0.19
18 0.18
19 0.15
20 0.12
21 0.11
22 0.11
23 0.12
24 0.14
25 0.13
26 0.13
27 0.14
28 0.13
29 0.14
30 0.13
31 0.12
32 0.09
33 0.08
34 0.09
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.09
41 0.11
42 0.09
43 0.11
44 0.14
45 0.15
46 0.16
47 0.19
48 0.2
49 0.28
50 0.32
51 0.31
52 0.3
53 0.31
54 0.32
55 0.33
56 0.3
57 0.24
58 0.28
59 0.35
60 0.39
61 0.46
62 0.51
63 0.54
64 0.61
65 0.66
66 0.67
67 0.69
68 0.7
69 0.72
70 0.73
71 0.76
72 0.76