Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BLZ3

Protein Details
Accession A0A0D0BLZ3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-87RGTEYQPSQRKRKRKHGFLSRKKTSTGBasic
NLS Segment(s)
PositionSequence
70-100RKRKRKHGFLSRKKTSTGRKILARRLLKGRR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFLQLLGALRRPLLNLPSFAAANPIIPASRSILINRALLVPQTLSLPSLCDALGQRRFASRGTEYQPSQRKRKRKHGFLSRKKTSTGRKILARRLLKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.23
5 0.23
6 0.21
7 0.21
8 0.16
9 0.14
10 0.13
11 0.11
12 0.09
13 0.09
14 0.1
15 0.1
16 0.12
17 0.13
18 0.13
19 0.16
20 0.18
21 0.18
22 0.18
23 0.16
24 0.14
25 0.13
26 0.13
27 0.09
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.13
40 0.16
41 0.16
42 0.16
43 0.17
44 0.18
45 0.18
46 0.21
47 0.18
48 0.2
49 0.23
50 0.28
51 0.27
52 0.35
53 0.43
54 0.45
55 0.53
56 0.56
57 0.63
58 0.67
59 0.77
60 0.8
61 0.81
62 0.86
63 0.87
64 0.91
65 0.91
66 0.93
67 0.91
68 0.83
69 0.76
70 0.74
71 0.72
72 0.71
73 0.69
74 0.66
75 0.66
76 0.71
77 0.76
78 0.78
79 0.73
80 0.7
81 0.71
82 0.73
83 0.7
84 0.72