Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZXH2

Protein Details
Accession A0A0C9ZXH2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
46-69DLMTKGPRKPGRIRNKRRMNEIIPHydrophilic
NLS Segment(s)
PositionSequence
50-63KGPRKPGRIRNKRR
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MISFSKTCTVMPKTNFITTIERKIVRAYEVPAPRPRTKSELRAQVDLMTKGPRKPGRIRNKRRMNEIIPDAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.4
4 0.42
5 0.38
6 0.42
7 0.4
8 0.37
9 0.35
10 0.35
11 0.33
12 0.28
13 0.26
14 0.22
15 0.24
16 0.26
17 0.3
18 0.34
19 0.39
20 0.4
21 0.41
22 0.41
23 0.39
24 0.4
25 0.44
26 0.45
27 0.48
28 0.48
29 0.47
30 0.45
31 0.43
32 0.42
33 0.35
34 0.29
35 0.25
36 0.25
37 0.24
38 0.33
39 0.33
40 0.37
41 0.45
42 0.54
43 0.6
44 0.69
45 0.78
46 0.81
47 0.87
48 0.87
49 0.87
50 0.85
51 0.79
52 0.77