Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BH41

Protein Details
Accession A0A0D0BH41    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-84ADGSVELRRPRKRRKVADKKSNSIKTTHydrophilic
NLS Segment(s)
PositionSequence
65-77RRPRKRRKVADKK
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 6.5, extr 3
Family & Domain DBs
Amino Acid Sequences MASAVTTKFQAALPFALLPISPSLAALHASRARSLYPAEFDSSSITNCLQCGSYLLAADGSVELRRPRKRRKVADKKSNSIKTTCHHCGFVSYTSFDRRETFPQSKPTTAAALVPSSVPPVSVSSRSERKPKEELIPPSSRSSVPISSSHVAHLTRGTTPDLHTKPQKKATILQEMLARSREKEASRTKSQQKPQLSGLASFLGSLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.13
5 0.12
6 0.11
7 0.11
8 0.09
9 0.09
10 0.09
11 0.1
12 0.12
13 0.11
14 0.15
15 0.18
16 0.19
17 0.2
18 0.2
19 0.2
20 0.2
21 0.22
22 0.19
23 0.19
24 0.2
25 0.22
26 0.21
27 0.21
28 0.22
29 0.21
30 0.18
31 0.16
32 0.15
33 0.12
34 0.12
35 0.12
36 0.1
37 0.09
38 0.1
39 0.11
40 0.11
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.07
47 0.06
48 0.05
49 0.07
50 0.11
51 0.18
52 0.26
53 0.35
54 0.45
55 0.56
56 0.66
57 0.75
58 0.83
59 0.87
60 0.9
61 0.93
62 0.91
63 0.88
64 0.88
65 0.84
66 0.74
67 0.65
68 0.57
69 0.5
70 0.5
71 0.48
72 0.39
73 0.33
74 0.31
75 0.31
76 0.3
77 0.28
78 0.21
79 0.17
80 0.17
81 0.19
82 0.2
83 0.19
84 0.18
85 0.18
86 0.21
87 0.27
88 0.3
89 0.3
90 0.38
91 0.39
92 0.38
93 0.37
94 0.34
95 0.28
96 0.24
97 0.21
98 0.14
99 0.11
100 0.11
101 0.09
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.08
108 0.1
109 0.12
110 0.14
111 0.18
112 0.24
113 0.28
114 0.36
115 0.36
116 0.39
117 0.42
118 0.44
119 0.46
120 0.48
121 0.51
122 0.5
123 0.53
124 0.5
125 0.48
126 0.46
127 0.39
128 0.33
129 0.31
130 0.26
131 0.23
132 0.23
133 0.26
134 0.26
135 0.26
136 0.24
137 0.24
138 0.22
139 0.2
140 0.2
141 0.15
142 0.15
143 0.16
144 0.17
145 0.15
146 0.17
147 0.26
148 0.27
149 0.32
150 0.4
151 0.45
152 0.51
153 0.59
154 0.62
155 0.56
156 0.61
157 0.62
158 0.63
159 0.58
160 0.52
161 0.48
162 0.44
163 0.44
164 0.39
165 0.33
166 0.23
167 0.27
168 0.3
169 0.27
170 0.34
171 0.42
172 0.46
173 0.54
174 0.63
175 0.68
176 0.72
177 0.79
178 0.79
179 0.77
180 0.74
181 0.7
182 0.68
183 0.61
184 0.52
185 0.46
186 0.39
187 0.31