Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZSW1

Protein Details
Accession A0A0C9ZSW1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-96FCLSWFQKKKKKEVPRPVYDDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
Amino Acid Sequences MAYLCIITLFPAKLTSPLSRPRANSPVRSSSDKGTQKAHGPRREVAHTVDVPLGQATYADVVGVDDGERPYVLFFCLSWFQKKKKKEVPRPVYDDELEDDEEEENVCGPAGVPPPRALHEEIELTLAGHNQRQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.33
5 0.39
6 0.42
7 0.45
8 0.49
9 0.55
10 0.57
11 0.58
12 0.56
13 0.58
14 0.58
15 0.61
16 0.56
17 0.51
18 0.55
19 0.53
20 0.49
21 0.44
22 0.42
23 0.44
24 0.52
25 0.56
26 0.53
27 0.51
28 0.52
29 0.53
30 0.54
31 0.48
32 0.41
33 0.38
34 0.32
35 0.29
36 0.26
37 0.21
38 0.17
39 0.15
40 0.12
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.04
61 0.04
62 0.07
63 0.11
64 0.13
65 0.2
66 0.24
67 0.32
68 0.39
69 0.44
70 0.52
71 0.58
72 0.68
73 0.71
74 0.78
75 0.8
76 0.82
77 0.84
78 0.78
79 0.72
80 0.61
81 0.52
82 0.42
83 0.35
84 0.26
85 0.19
86 0.16
87 0.12
88 0.12
89 0.11
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.08
97 0.14
98 0.17
99 0.18
100 0.21
101 0.24
102 0.27
103 0.3
104 0.29
105 0.26
106 0.26
107 0.26
108 0.24
109 0.23
110 0.21
111 0.17
112 0.16
113 0.16
114 0.14