Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A419

Protein Details
Accession A0A0D0A419    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-114KTATPPPNKNAKKRANARAKKNAEKAAHydrophilic
NLS Segment(s)
PositionSequence
85-112PKGKTATPPPNKNAKKRANARAKKNAEK
Subcellular Location(s) mito 8, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MARPPLFPDQSAAGIAVDPRTLERVIPESKRSDGTVRKQLKIRPGFTPQEDVSRFRGSRQQAMDATALPKGHILGWVAPSAATPPKGKTATPPPNKNAKKRANARAKKNAEKAAIIKDNWEDEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.09
5 0.08
6 0.08
7 0.1
8 0.11
9 0.1
10 0.12
11 0.17
12 0.22
13 0.26
14 0.29
15 0.3
16 0.31
17 0.33
18 0.33
19 0.34
20 0.36
21 0.4
22 0.46
23 0.49
24 0.51
25 0.54
26 0.55
27 0.58
28 0.58
29 0.53
30 0.48
31 0.49
32 0.49
33 0.46
34 0.48
35 0.39
36 0.38
37 0.37
38 0.35
39 0.32
40 0.33
41 0.31
42 0.27
43 0.32
44 0.27
45 0.32
46 0.3
47 0.3
48 0.25
49 0.28
50 0.27
51 0.21
52 0.2
53 0.15
54 0.14
55 0.1
56 0.09
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.09
68 0.1
69 0.11
70 0.11
71 0.13
72 0.19
73 0.21
74 0.21
75 0.26
76 0.35
77 0.43
78 0.52
79 0.57
80 0.57
81 0.67
82 0.74
83 0.76
84 0.76
85 0.74
86 0.75
87 0.77
88 0.82
89 0.83
90 0.84
91 0.86
92 0.86
93 0.86
94 0.85
95 0.83
96 0.8
97 0.72
98 0.68
99 0.61
100 0.6
101 0.57
102 0.48
103 0.43
104 0.39
105 0.38