Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BTE3

Protein Details
Accession A0A0D0BTE3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
124-146AGVGSAKWKRFRRKVDEISRAVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR006722  Sedlin  
IPR044760  TRAPPC2L  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
Pfam View protein in Pfam  
PF04628  Sedlin_N  
CDD cd14854  TRAPPC2L  
Amino Acid Sequences MAPLLRLNAVAFISPHNHPILIRTFEKGDELKYHYVAHTSLDVIEERTNGQTKSNDCYLGLLYAMDDIAAYGYITPLKMKIVLALPLTDSVVRDAEVIMTFRALHLAYYHASSNPFIRLHDTPAGVGSAKWKRFRRKVDEISRAVGGGSVPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.18
5 0.17
6 0.2
7 0.24
8 0.26
9 0.26
10 0.26
11 0.27
12 0.27
13 0.3
14 0.27
15 0.24
16 0.23
17 0.26
18 0.26
19 0.26
20 0.27
21 0.23
22 0.24
23 0.21
24 0.18
25 0.14
26 0.12
27 0.11
28 0.11
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.12
35 0.14
36 0.14
37 0.16
38 0.18
39 0.19
40 0.23
41 0.24
42 0.22
43 0.2
44 0.21
45 0.18
46 0.15
47 0.13
48 0.08
49 0.06
50 0.05
51 0.05
52 0.04
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.07
68 0.08
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.06
91 0.06
92 0.06
93 0.08
94 0.08
95 0.1
96 0.11
97 0.11
98 0.12
99 0.13
100 0.14
101 0.16
102 0.16
103 0.15
104 0.2
105 0.2
106 0.24
107 0.27
108 0.26
109 0.22
110 0.22
111 0.23
112 0.18
113 0.16
114 0.2
115 0.24
116 0.29
117 0.38
118 0.46
119 0.55
120 0.65
121 0.75
122 0.76
123 0.79
124 0.84
125 0.86
126 0.87
127 0.8
128 0.75
129 0.66
130 0.56
131 0.45
132 0.35