Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AA46

Protein Details
Accession A0A0D0AA46    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-79QEVSRQRRHEKKGVKRRRLSSERWRRMFBasic
NLS Segment(s)
PositionSequence
55-85SRQRRHEKKGVKRRRLSSERWRRMFANEVRK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences TPDERWAERSRGLTLPPPADPYTGLRIYVAENQLGEGFRRLQTRLRRNRLIQEVSRQRRHEKKGVKRRRLSSERWRRMFANEVRKKVQLVSTIRRRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.33
4 0.35
5 0.32
6 0.3
7 0.29
8 0.26
9 0.27
10 0.25
11 0.23
12 0.19
13 0.18
14 0.2
15 0.23
16 0.21
17 0.15
18 0.14
19 0.14
20 0.15
21 0.15
22 0.13
23 0.1
24 0.1
25 0.12
26 0.14
27 0.15
28 0.2
29 0.3
30 0.4
31 0.48
32 0.55
33 0.58
34 0.59
35 0.65
36 0.65
37 0.61
38 0.53
39 0.52
40 0.55
41 0.56
42 0.61
43 0.56
44 0.57
45 0.6
46 0.65
47 0.64
48 0.63
49 0.67
50 0.71
51 0.8
52 0.82
53 0.82
54 0.84
55 0.85
56 0.82
57 0.8
58 0.8
59 0.81
60 0.8
61 0.76
62 0.72
63 0.63
64 0.61
65 0.61
66 0.59
67 0.58
68 0.56
69 0.58
70 0.58
71 0.58
72 0.55
73 0.49
74 0.46
75 0.43
76 0.43
77 0.47
78 0.54