Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0B088

Protein Details
Accession A0A0D0B088    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKKKERLNRKAHHKKQNKRQHFVRFNKSYABasic
81-100SKTRARPARKEVKKAWRAKEBasic
NLS Segment(s)
PositionSequence
2-52KKKERLNRKAHHKKQNKRQHFVRFNKSYANKRRVGYFPKNIRPLHRRRFLG
75-107PKETRESKTRARPARKEVKKAWRAKEQNARNER
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MKKKERLNRKAHHKKQNKRQHFVRFNKSYANKRRVGYFPKNIRPLHRRRFLGRRQNLAILERIVEDSDHIQRNGPKETRESKTRARPARKEVKKAWRAKEQNARNERAKTQRMRTLFEVWHCIKRFET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.92
5 0.9
6 0.89
7 0.89
8 0.89
9 0.88
10 0.87
11 0.82
12 0.74
13 0.74
14 0.72
15 0.71
16 0.71
17 0.69
18 0.64
19 0.59
20 0.63
21 0.6
22 0.62
23 0.6
24 0.6
25 0.62
26 0.65
27 0.71
28 0.67
29 0.69
30 0.69
31 0.7
32 0.7
33 0.68
34 0.64
35 0.63
36 0.71
37 0.73
38 0.74
39 0.71
40 0.67
41 0.61
42 0.61
43 0.55
44 0.47
45 0.39
46 0.28
47 0.21
48 0.15
49 0.13
50 0.09
51 0.08
52 0.07
53 0.07
54 0.11
55 0.13
56 0.12
57 0.14
58 0.16
59 0.2
60 0.25
61 0.25
62 0.22
63 0.26
64 0.33
65 0.36
66 0.39
67 0.42
68 0.44
69 0.52
70 0.6
71 0.63
72 0.66
73 0.68
74 0.73
75 0.78
76 0.78
77 0.77
78 0.77
79 0.78
80 0.78
81 0.8
82 0.78
83 0.78
84 0.76
85 0.76
86 0.78
87 0.75
88 0.76
89 0.75
90 0.74
91 0.69
92 0.68
93 0.65
94 0.65
95 0.65
96 0.63
97 0.64
98 0.66
99 0.63
100 0.64
101 0.62
102 0.6
103 0.55
104 0.51
105 0.52
106 0.48
107 0.53
108 0.49