Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H603

Protein Details
Accession C6H603   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-46GCIHVTRPERTKCKNHKRPKRGGPASGMBasic
NLS Segment(s)
PositionSequence
32-40KNHKRPKRG
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MLEGWEVAVKTLDVRGGTGCIHVTRPERTKCKNHKRPKRGGPASGMLREVILLAHLAQSKIWRSAKSPQAICETKFATLHQSLAPLSSLRCRYARRLRSEDIKDLLTTPKWRYITCISCSGFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.12
5 0.12
6 0.13
7 0.12
8 0.13
9 0.17
10 0.2
11 0.26
12 0.33
13 0.41
14 0.47
15 0.54
16 0.63
17 0.7
18 0.78
19 0.81
20 0.85
21 0.87
22 0.9
23 0.93
24 0.93
25 0.93
26 0.88
27 0.81
28 0.75
29 0.71
30 0.65
31 0.56
32 0.46
33 0.34
34 0.27
35 0.23
36 0.17
37 0.1
38 0.06
39 0.04
40 0.04
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.1
47 0.15
48 0.17
49 0.16
50 0.18
51 0.25
52 0.32
53 0.36
54 0.36
55 0.34
56 0.4
57 0.41
58 0.39
59 0.35
60 0.3
61 0.25
62 0.24
63 0.22
64 0.19
65 0.18
66 0.18
67 0.15
68 0.15
69 0.14
70 0.14
71 0.14
72 0.1
73 0.1
74 0.15
75 0.17
76 0.18
77 0.22
78 0.25
79 0.34
80 0.44
81 0.51
82 0.55
83 0.59
84 0.62
85 0.68
86 0.71
87 0.68
88 0.6
89 0.53
90 0.45
91 0.4
92 0.38
93 0.33
94 0.32
95 0.29
96 0.34
97 0.35
98 0.34
99 0.39
100 0.43
101 0.46
102 0.45
103 0.5