Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A706

Protein Details
Accession A0A0D0A706    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36PSSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
5-30KAPPPSSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPPPSSSGGKAAKKKKWSKGKVKDKAQHAVVCDKATFDRIMKEAPTWRLISQSILIERLKVNGSLARVAIRHLEKEGLIKRIVHHSGQLIYTRLTTASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.6
4 0.61
5 0.67
6 0.73
7 0.77
8 0.79
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.8
18 0.74
19 0.65
20 0.57
21 0.52
22 0.43
23 0.37
24 0.3
25 0.23
26 0.19
27 0.18
28 0.17
29 0.12
30 0.12
31 0.12
32 0.13
33 0.13
34 0.14
35 0.17
36 0.17
37 0.19
38 0.19
39 0.18
40 0.18
41 0.18
42 0.17
43 0.15
44 0.15
45 0.13
46 0.14
47 0.14
48 0.13
49 0.13
50 0.14
51 0.13
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.17
62 0.17
63 0.17
64 0.17
65 0.18
66 0.17
67 0.24
68 0.27
69 0.25
70 0.25
71 0.25
72 0.26
73 0.33
74 0.36
75 0.29
76 0.28
77 0.28
78 0.29
79 0.3
80 0.31
81 0.25
82 0.23
83 0.22
84 0.2