Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BJ76

Protein Details
Accession A0A0D0BJ76    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78EPIPTSYPVPKRPRKPVQGYEDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 7, plas 4, cyto 2, E.R. 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASILSPFRRGYRHLQHLAHEQPVIFYSCVLGLAGPVLALTVPAVRRNWLGYTPAEPIPTSYPVPKRPRKPVQGYEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.56
4 0.61
5 0.6
6 0.53
7 0.43
8 0.33
9 0.26
10 0.25
11 0.23
12 0.15
13 0.11
14 0.09
15 0.08
16 0.09
17 0.08
18 0.06
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.04
29 0.05
30 0.07
31 0.08
32 0.09
33 0.1
34 0.12
35 0.13
36 0.13
37 0.15
38 0.14
39 0.17
40 0.19
41 0.2
42 0.19
43 0.18
44 0.19
45 0.19
46 0.21
47 0.21
48 0.24
49 0.29
50 0.38
51 0.48
52 0.55
53 0.61
54 0.69
55 0.77
56 0.81
57 0.85
58 0.85