Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A5S6

Protein Details
Accession A0A0D0A5S6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-33VPVPNLTKKSRGRRVPTVNNAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences RKNARSLPVPVPVPNLTKKSRGRRVPTVNNAGGSGRARGYSDPLGSRIYLCDISGCGKCFARGEHLKRHIRSIHTNEKPHRCPYPGCGKEFSRHDNLGQHMKVHKDLPKLMERM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.38
4 0.44
5 0.51
6 0.57
7 0.63
8 0.68
9 0.7
10 0.74
11 0.81
12 0.83
13 0.83
14 0.8
15 0.72
16 0.64
17 0.56
18 0.46
19 0.39
20 0.29
21 0.21
22 0.13
23 0.12
24 0.12
25 0.12
26 0.15
27 0.15
28 0.16
29 0.16
30 0.17
31 0.17
32 0.17
33 0.16
34 0.13
35 0.13
36 0.11
37 0.1
38 0.08
39 0.08
40 0.1
41 0.12
42 0.12
43 0.11
44 0.11
45 0.12
46 0.13
47 0.13
48 0.18
49 0.24
50 0.28
51 0.36
52 0.45
53 0.51
54 0.51
55 0.56
56 0.53
57 0.5
58 0.53
59 0.52
60 0.54
61 0.54
62 0.61
63 0.63
64 0.69
65 0.68
66 0.65
67 0.61
68 0.54
69 0.48
70 0.48
71 0.52
72 0.47
73 0.47
74 0.47
75 0.45
76 0.5
77 0.53
78 0.52
79 0.48
80 0.44
81 0.43
82 0.43
83 0.46
84 0.47
85 0.42
86 0.41
87 0.38
88 0.39
89 0.4
90 0.4
91 0.41
92 0.38
93 0.42
94 0.44