Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BD15

Protein Details
Accession A0A0D0BD15    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-107DVEDKKKRGKGAPKKAKEKGDSRRASRRRBasic
NLS Segment(s)
PositionSequence
83-107KKKRGKGAPKKAKEKGDSRRASRRR
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAAIRPMRLAALTRSRCSIFQTAYNPTSARTGAKYLRARLRGPSMVKYYTPEANIAQIMRQWPGLEIINFAEEERLRDVEDKKKRGKGAPKKAKEKGDSRRASRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.36
5 0.39
6 0.38
7 0.3
8 0.31
9 0.34
10 0.37
11 0.36
12 0.38
13 0.32
14 0.28
15 0.28
16 0.23
17 0.2
18 0.15
19 0.19
20 0.2
21 0.28
22 0.32
23 0.36
24 0.42
25 0.44
26 0.44
27 0.43
28 0.46
29 0.43
30 0.41
31 0.39
32 0.35
33 0.33
34 0.32
35 0.31
36 0.27
37 0.24
38 0.22
39 0.19
40 0.15
41 0.14
42 0.15
43 0.12
44 0.1
45 0.09
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.1
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.11
62 0.12
63 0.12
64 0.12
65 0.17
66 0.21
67 0.28
68 0.38
69 0.44
70 0.49
71 0.55
72 0.59
73 0.63
74 0.7
75 0.72
76 0.74
77 0.77
78 0.8
79 0.84
80 0.87
81 0.87
82 0.84
83 0.83
84 0.82
85 0.82
86 0.81
87 0.79