Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A2N3

Protein Details
Accession A0A0D0A2N3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71VGLGCWRRFKARRNAARASCHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MATACDIGISTGVPASIESSIVPAPAIYYPLQHLIGMLQMSGVQMMSRFERVGLGCWRRFKARRNAARASC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.06
4 0.07
5 0.06
6 0.08
7 0.08
8 0.08
9 0.08
10 0.06
11 0.06
12 0.06
13 0.08
14 0.07
15 0.07
16 0.08
17 0.11
18 0.11
19 0.1
20 0.1
21 0.08
22 0.09
23 0.08
24 0.07
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.03
32 0.05
33 0.06
34 0.07
35 0.08
36 0.08
37 0.11
38 0.11
39 0.16
40 0.23
41 0.29
42 0.32
43 0.38
44 0.41
45 0.47
46 0.53
47 0.58
48 0.61
49 0.65
50 0.7
51 0.73