Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZQF2

Protein Details
Accession A0A0C9ZQF2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
46-82AEAHIKEKPATEKKRKRREKEKERKIKKRKLAETVEVBasic
NLS Segment(s)
PositionSequence
51-75KEKPATEKKRKRREKEKERKIKKRK
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MNGQRGDDLDDDFVPDELVATSGEEDNGPGDDIGGLLSADEDAEEAEAHIKEKPATEKKRKRREKEKERKIKKRKLAETVEVIEPLSVAVQPAHKLADYVSSMQVKAFPAMSGIELSDVLIPASSIADTTKWTGSRSLDNLVDFIIEVLPTLHTRISQRSKAAGAPTLLFIAGAALRVADATRVLKDKRLRREKGADVAKLFARHFKLEEHVSYLKRSKIGSAVGTPGRIGKLLCETDALSVSQLTHIILDLSYRDTKKRSLLDIPETRDEVFRTVLGAPMVLKGIQEGKIQLVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.1
4 0.08
5 0.08
6 0.07
7 0.07
8 0.08
9 0.08
10 0.09
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.07
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.07
34 0.08
35 0.09
36 0.11
37 0.12
38 0.13
39 0.17
40 0.26
41 0.33
42 0.44
43 0.54
44 0.64
45 0.73
46 0.83
47 0.9
48 0.91
49 0.92
50 0.93
51 0.94
52 0.94
53 0.95
54 0.95
55 0.95
56 0.96
57 0.96
58 0.95
59 0.92
60 0.92
61 0.89
62 0.87
63 0.83
64 0.78
65 0.73
66 0.66
67 0.58
68 0.47
69 0.39
70 0.29
71 0.21
72 0.15
73 0.09
74 0.05
75 0.04
76 0.05
77 0.06
78 0.07
79 0.08
80 0.09
81 0.09
82 0.09
83 0.09
84 0.12
85 0.12
86 0.13
87 0.16
88 0.16
89 0.17
90 0.16
91 0.18
92 0.14
93 0.14
94 0.12
95 0.09
96 0.08
97 0.09
98 0.09
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.03
110 0.04
111 0.03
112 0.03
113 0.03
114 0.04
115 0.05
116 0.07
117 0.09
118 0.1
119 0.11
120 0.13
121 0.14
122 0.17
123 0.18
124 0.2
125 0.19
126 0.18
127 0.17
128 0.15
129 0.13
130 0.1
131 0.08
132 0.05
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.05
139 0.05
140 0.06
141 0.08
142 0.15
143 0.21
144 0.24
145 0.25
146 0.26
147 0.27
148 0.28
149 0.28
150 0.23
151 0.19
152 0.16
153 0.15
154 0.13
155 0.12
156 0.09
157 0.08
158 0.05
159 0.05
160 0.04
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.03
167 0.04
168 0.05
169 0.07
170 0.11
171 0.12
172 0.18
173 0.26
174 0.33
175 0.43
176 0.52
177 0.55
178 0.58
179 0.66
180 0.65
181 0.67
182 0.66
183 0.58
184 0.49
185 0.47
186 0.42
187 0.37
188 0.32
189 0.28
190 0.24
191 0.22
192 0.22
193 0.21
194 0.24
195 0.25
196 0.25
197 0.26
198 0.28
199 0.28
200 0.31
201 0.34
202 0.31
203 0.3
204 0.3
205 0.26
206 0.25
207 0.27
208 0.25
209 0.23
210 0.26
211 0.25
212 0.25
213 0.24
214 0.21
215 0.19
216 0.17
217 0.15
218 0.11
219 0.16
220 0.17
221 0.17
222 0.17
223 0.17
224 0.18
225 0.19
226 0.17
227 0.11
228 0.1
229 0.1
230 0.1
231 0.1
232 0.08
233 0.07
234 0.07
235 0.07
236 0.06
237 0.07
238 0.07
239 0.11
240 0.17
241 0.18
242 0.22
243 0.24
244 0.29
245 0.35
246 0.39
247 0.41
248 0.44
249 0.49
250 0.56
251 0.61
252 0.63
253 0.6
254 0.57
255 0.52
256 0.46
257 0.4
258 0.32
259 0.26
260 0.2
261 0.17
262 0.16
263 0.17
264 0.15
265 0.15
266 0.13
267 0.12
268 0.13
269 0.11
270 0.11
271 0.1
272 0.14
273 0.16
274 0.18
275 0.18
276 0.19